PINX1 Antikörper (N-Term)

Produktnummer ABIN630717

Produktdetails anti-PINX1 Antikörper

Target: PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PINX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PINX1 antibody was raised against the N terminal of PINX1

Aufreinigung: Affinity purified

Immunogen: PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PINX1 Blocking Peptide, catalog no. 33R-2516, is also available for use as a blocking control in assays to test for specificity of this PINX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PINX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PINX1

Target: PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))

Andere Bezeichnung: PINX1 (PINX1 Produkte)

Synonyme: PINX1 antikoerper, LPTL antikoerper, LPTS antikoerper, 2210403I16Rik antikoerper, 2610028A01Rik antikoerper, 67-11-3 antikoerper, AU024023 antikoerper, LPTS1 antikoerper, RGD1566025 antikoerper, PIN2/TERF1 interacting telomerase inhibitor 1 antikoerper, PIN2/TERF1 interacting, telomerase inhibitor 1 antikoerper, PINX1 antikoerper, Pinx1 antikoerper

Hintergrund: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres.

Molekulargewicht: 37 kDa (MW of target protein)