CEP55 Antikörper (Middle Region)
-
- Target Alle CEP55 Antikörper anzeigen
- CEP55 (Centrosomal Protein 55kDa (CEP55))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CEP55 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CEP55 antibody was raised against the middle region of CEP55
- Aufreinigung
- Affinity purified
- Immunogen
- CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
- Top Product
- Discover our top product CEP55 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CEP55 Blocking Peptide, catalog no. 33R-9162, is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEP55 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEP55 (Centrosomal Protein 55kDa (CEP55))
- Andere Bezeichnung
- CEP55 (CEP55 Produkte)
- Synonyme
- C10orf3 antikoerper, CT111 antikoerper, URCC6 antikoerper, RGD1305340 antikoerper, 1200008O12Rik antikoerper, 2700032M20Rik antikoerper, centrosomal protein 55 antikoerper, CEP55 antikoerper, Cep55 antikoerper
- Hintergrund
- CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
- Molekulargewicht
- 54 kDa (MW of target protein)
-