MNS1 Antikörper (Middle Region)
-
- Target Alle MNS1 Antikörper anzeigen
- MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MNS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MNS1 antibody was raised against the middle region of MNS1
- Aufreinigung
- Affinity purified
- Immunogen
- MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL
- Top Product
- Discover our top product MNS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MNS1 Blocking Peptide, catalog no. 33R-4719, is also available for use as a blocking control in assays to test for specificity of this MNS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MNS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))
- Andere Bezeichnung
- MNS1 (MNS1 Produkte)
- Synonyme
- SPATA40 antikoerper, sb:cb494 antikoerper, zgc:65845 antikoerper, AW546487 antikoerper, meiosis specific nuclear structural 1 antikoerper, meiosis-specific nuclear structural 1 antikoerper, meiosis-specific nuclear structural protein 1 antikoerper, MNS1 antikoerper, mns1 antikoerper, Mns1 antikoerper
- Hintergrund
- This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein.
- Molekulargewicht
- 60 kDa (MW of target protein)
-