IVNS1ABP Antikörper (N-Term)
-
- Target Alle IVNS1ABP Antikörper anzeigen
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Influenza A Virus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IVNS1ABP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Influenza Virus Ns1 A Binding Protein antibody was raised against the N terminal of IVNS1 BP
- Kreuzreaktivität
- Human, Hund
- Aufreinigung
- Affinity purified
- Immunogen
- Influenza Virus Ns1 A Binding Protein antibody was raised using the N terminal of IVNS1 BP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
- Top Product
- Discover our top product IVNS1ABP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVNS0 BP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
- Andere Bezeichnung
- Influenza Virus Ns1A Binding Protein (IVNS1ABP Produkte)
- Substanzklasse
- Influenza Protein
- Hintergrund
- This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.
- Molekulargewicht
- 72 kDa (MW of target protein)
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-