NUSAP1 Antikörper (Middle Region)
-
- Target Alle NUSAP1 Antikörper anzeigen
- NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUSAP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NUSAP1 antibody was raised against the middle region of NUSAP1
- Aufreinigung
- Affinity purified
- Immunogen
- NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
- Top Product
- Discover our top product NUSAP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUSAP1 Blocking Peptide, catalog no. 33R-1139, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUSAP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))
- Andere Bezeichnung
- NUSAP1 (NUSAP1 Produkte)
- Synonyme
- ANKT antikoerper, BM037 antikoerper, LNP antikoerper, NUSAP antikoerper, PRO0310p1 antikoerper, Q0310 antikoerper, SAPL antikoerper, 2610201A12Rik antikoerper, AI481307 antikoerper, AW547774 antikoerper, BB165529 antikoerper, NuSAP antikoerper, YF-9 antikoerper, ankt antikoerper, fb76a01 antikoerper, fi37a11 antikoerper, sb:cb490 antikoerper, wu:fb76a01 antikoerper, wu:fi37a11 antikoerper, lnp antikoerper, nusap antikoerper, nusap1 antikoerper, sapl antikoerper, nucleolar and spindle associated protein 1 antikoerper, nucleolar and spindle associated protein 1 L homeolog antikoerper, nucleolar and spindle associated protein 1 S homeolog antikoerper, NUSAP1 antikoerper, Nusap1 antikoerper, nusap1 antikoerper, nusap1.L antikoerper, nusap1.S antikoerper
- Hintergrund
- NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
- Molekulargewicht
- 49 kDa (MW of target protein)
-