FAD Synthetase Antikörper
-
- Target Alle FAD Synthetase Produkte
- FAD Synthetase
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAD Synthetase Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV
-
anti-FAD Synthetase (AA 1-490) antibody
Reaktivität: Human ELISA, WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-FAD Synthetase (AA 551-580), (C-Term) antibodyReaktivität: Human WB Wirt: Kaninchen Polyclonal RB23920 unconjugated
anti-FAD Synthetase (AA 388-587) antibodyReaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-FAD Synthetase (AA 107-156) antibodyReaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen, Fledermaus, Affe, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLAD1 Blocking Peptide, catalog no. 33R-7130, is also available for use as a blocking control in assays to test for specificity of this FLAD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLAD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAD Synthetase
- Andere Bezeichnung
- FLAD1 (FAD Synthetase Produkte)
- Hintergrund
- FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.
- Molekulargewicht
- 65 kDa (MW of target protein)
-
