METTL11B Antikörper (C-Term)

Produktnummer ABIN630741

Produktdetails anti-METTL11B Antikörper

Target: METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METTL11B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF184 antibody was raised against the C terminal Of C1 rf184

Aufreinigung: Affinity purified

Immunogen: C1 ORF184 antibody was raised using the C terminal Of C1 rf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF184 Blocking Peptide, catalog no. 33R-6909, is also available for use as a blocking control in assays to test for specificity of this C1ORF184 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF184 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METTL11B

Target: METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))

Andere Bezeichnung: C1ORF184 (C1ORF184 Produkte)

Synonyme: C1orf184 antikoerper, HOMT1B antikoerper, NTM1B antikoerper, Gm207 antikoerper, RGD1564106 antikoerper, methyltransferase like 11B antikoerper, METTL11B antikoerper, Mettl11b antikoerper, mettl11b antikoerper

Hintergrund: C1orf184 (Alpha-N-methyltransferase) methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala, Pro or Ser residue in the [Ala/Pro/Ser]-Pro-Lys motif.

Molekulargewicht: 32 kDa (MW of target protein)