ALG1L3P Antikörper (C-Term)
-
- Target Alle ALG1L3P Produkte
- ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))
- Bindungsspezifität
- C-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALG1L3P Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LOC650515 antibody was raised against the C terminal of LOC650515
- Aufreinigung
- Affinity purified
- Immunogen
- LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LOC650515 Blocking Peptide, catalog no. 33R-9764, is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC650515 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))
- Abstract
- ALG1L3P Produkte
- Hintergrund
- The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.
- Molekulargewicht
- 39 kDa (MW of target protein)
-