GGN Antikörper (N-Term)
-
- Target Alle GGN Antikörper anzeigen
- GGN (Gametogenetin (GGN))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GGN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GGN antibody was raised against the N terminal of GGN
- Aufreinigung
- Affinity purified
- Immunogen
- GGN antibody was raised using the N terminal of GGN corresponding to a region with amino acids GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT
- Top Product
- Discover our top product GGN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GGN Blocking Peptide, catalog no. 33R-3484, is also available for use as a blocking control in assays to test for specificity of this GGN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGN (Gametogenetin (GGN))
- Andere Bezeichnung
- GGN (GGN Produkte)
- Synonyme
- AI593290 antikoerper, gametogenetin antikoerper, GGN antikoerper, Ggn antikoerper
- Hintergrund
- GGN may be involved in spermatogenesis.
- Molekulargewicht
- 67 kDa (MW of target protein)
-