CENPP Antikörper (N-Term)
-
- Target Alle CENPP Antikörper anzeigen
- CENPP (Centromere Protein P (CENPP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CENPP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CENPP antibody was raised against the N terminal of CENPP
- Aufreinigung
- Affinity purified
- Immunogen
- CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ
- Top Product
- Discover our top product CENPP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CENPP Blocking Peptide, catalog no. 33R-9748, is also available for use as a blocking control in assays to test for specificity of this CENPP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CENPP (Centromere Protein P (CENPP))
- Andere Bezeichnung
- CENPP (CENPP Produkte)
- Synonyme
- CENP-P antikoerper, 1700022C02Rik antikoerper, 4921518G09Rik antikoerper, si:ch211-103f16.3 antikoerper, wu:fb81h12 antikoerper, zgc:101125 antikoerper, centromere protein P antikoerper, CENPP antikoerper, Cenpp antikoerper, cenpp antikoerper
- Hintergrund
- CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
- Molekulargewicht
- 33 kDa (MW of target protein)
-