NUP43 Antikörper (Middle Region)
-
- Target Alle NUP43 Antikörper anzeigen
- NUP43 (Nucleoporin 43kDa (NUP43))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NUP43 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NUP43 antibody was raised against the middle region of NUP43
- Aufreinigung
- Affinity purified
- Immunogen
- NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI
- Top Product
- Discover our top product NUP43 Primärantikörper
-
anti-Nucleoporin 43kDa (NUP43) (AA 281-380) antibody
NUP43 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2G5 unconjugated
anti-Nucleoporin 43kDa (NUP43) (AA 1-380) antibodyNUP43 Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Nucleoporin 43kDa (NUP43) (AA 1-200) antibodyNUP43 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 43kDa (NUP43) (AA 142-171) antibodyNUP43 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB37196 unconjugated
anti-Nucleoporin 43kDa (NUP43) (C-Term) antibodyNUP43 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 43kDa (NUP43) (AA 150-260) antibodyNUP43 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Nucleoporin 43kDa (NUP43) (Middle Region) antibodyNUP43 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NUP43 Blocking Peptide, catalog no. 33R-3830, is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP43 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUP43 (Nucleoporin 43kDa (NUP43))
- Andere Bezeichnung
- NUP43 (NUP43 Produkte)
- Synonyme
- MGC184722 antikoerper, MGC154553 antikoerper, 2610016K01Rik antikoerper, 2610529I12Rik antikoerper, AA409950 antikoerper, p42 antikoerper, bA350J20.1 antikoerper, nucleoporin 43 antikoerper, nucleoporin 43kDa antikoerper, nucleoporin Nup43 antikoerper, nucleoporin 43kDa S homeolog antikoerper, NUP43 antikoerper, nup43 antikoerper, LOC696374 antikoerper, nup43.S antikoerper, Nup43 antikoerper
- Hintergrund
- NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
