Myosin IC Antikörper (N-Term)
-
- Target Alle Myosin IC (MYO1C) Antikörper anzeigen
- Myosin IC (MYO1C)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Myosin IC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Myosin Ic antibody was raised against the N terminal of MYO1 C
- Aufreinigung
- Affinity purified
- Immunogen
- Myosin Ic antibody was raised using the N terminal of MYO1 C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
- Top Product
- Discover our top product MYO1C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Myosin Ic Blocking Peptide, catalog no. 33R-6834, is also available for use as a blocking control in assays to test for specificity of this Myosin Ic antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Myosin IC (MYO1C)
- Andere Bezeichnung
- Myosin Ic (MYO1C Produkte)
- Hintergrund
- This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.
- Molekulargewicht
- 113 kDa (MW of target protein)
- Pathways
- Platelet-derived growth Factor Receptor Signaling
-