RAP1GAP Antikörper (Middle Region)
-
- Target Alle RAP1GAP Antikörper anzeigen
- RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAP1GAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAP1 GAP antibody was raised against the middle region of RAP1 AP
- Aufreinigung
- Affinity purified
- Immunogen
- RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
- Top Product
- Discover our top product RAP1GAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAP1GAP Blocking Peptide, catalog no. 33R-3948, is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))
- Andere Bezeichnung
- RAP1GAP (RAP1GAP Produkte)
- Synonyme
- RAP1GA1 antikoerper, RAP1GAP1 antikoerper, RAP1GAPII antikoerper, RAPGAP antikoerper, 1300019I11Rik antikoerper, 2310004O14Rik antikoerper, AI427470 antikoerper, Rap1ga1 antikoerper, RAP1 antikoerper, RAP1GAP antikoerper, rap1ga1 antikoerper, rap1gap1 antikoerper, rap1gapii antikoerper, rapgap antikoerper, zgc:175180 antikoerper, DKFZp459A114 antikoerper, RAP1 GTPase activating protein antikoerper, Rap1 GTPase-activating protein antikoerper, RAP1 GTPase activating protein 1 antikoerper, RAP1 GTPase activating protein L homeolog antikoerper, Rap1 GTPase-activating protein 1 antikoerper, si:dkey-166d12.2 antikoerper, RAP1GAP antikoerper, Rap1gap antikoerper, RAP1GAP1 antikoerper, rap1gap.L antikoerper, Tsp_09520 antikoerper, rap1gap antikoerper, si:dkey-166d12.2 antikoerper
- Hintergrund
- RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.
- Molekulargewicht
- 73 kDa (MW of target protein)
-