ACTR1A Antikörper

Produktnummer ABIN630759

Produktdetails anti-ACTR1A Antikörper

Target: ACTR1A (Alpha Centractin (ACTR1A))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTR1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ACTR1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTR1A Blocking Peptide, catalog no. 33R-1269, is also available for use as a blocking control in assays to test for specificity of this ACTR1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTR1A

Target: ACTR1A (Alpha Centractin (ACTR1A))

Andere Bezeichnung: ACTR1A (ACTR1A Produkte)

Synonyme: ARP1 antikoerper, CTRN1 antikoerper, Arp1 antikoerper, alpha-Arp1 antikoerper, arp1 antikoerper, centractin antikoerper, ctrn1 antikoerper, ACTR1A antikoerper, ARP1 actin related protein 1 homolog A antikoerper, ARP1 actin-related protein 1A, centractin alpha antikoerper, ARP1 actin-related protein 1 homolog A, centractin alpha antikoerper, ARP1 actin related protein 1 homolog A L homeolog antikoerper, alpha-centractin antikoerper, actin-2 antikoerper, ACTR1A antikoerper, Actr1a antikoerper, actr1a.L antikoerper, actr1a antikoerper, PTRG_02540 antikoerper, PAAG_06972 antikoerper, MCYG_01044 antikoerper, VDBG_00685 antikoerper, MGYG_00946 antikoerper, DICPUDRAFT_88548 antikoerper, PGTG_04034 antikoerper, Tsp_06409 antikoerper

Hintergrund: ACTR1A is a 42.6 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: M Phase