GAPDH Antikörper (Middle Region)
-
- Target Alle GAPDH Antikörper anzeigen
- GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GAPDH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GAPDH antibody was raised against the middle region of GAPDH
- Aufreinigung
- Affinity purified
- Immunogen
- GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
- Top Product
- Discover our top product GAPDH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GAPDH Blocking Peptide, catalog no. 33R-4240, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).
: "Calcineurin protects the heart in a murine model of dilated cardiomyopathy." in: Journal of molecular and cellular cardiology, Vol. 48, Issue 6, pp. 1080-7, (2010) (PubMed).
: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).
: "Diabetes-relevant regulation of cultured blood outgrowth endothelial cells." in: Microvascular research, Vol. 78, Issue 2, pp. 174-9, (2009) (PubMed).
: "
-
Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).
-
- Target
- GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
- Andere Bezeichnung
- GAPDH (GAPDH Produkte)
- Synonyme
- G3PD antikoerper, GAPD antikoerper, Gapd antikoerper, BEST:GH12586 antikoerper, CG12055 antikoerper, Dmel\\CG12055 antikoerper, GA3PDH antikoerper, GADPH antikoerper, GAP antikoerper, GAPDH antikoerper, GAPDH I antikoerper, GAPDH-1 antikoerper, GAPDH1 antikoerper, GAPDHI antikoerper, Gapdh antikoerper, Gapdh-1 antikoerper, Gapdh43E antikoerper, gadph antikoerper, gapdh antikoerper, gapdh-1 antikoerper, gh12586 antikoerper, cb609 antikoerper, gapd antikoerper, mg:bb02e05 antikoerper, wu:fb33a10 antikoerper, wu:ft80f05 antikoerper, KNC-NDS6 antikoerper, g3pd antikoerper, G3PDH antikoerper, glyceraldehyde-3-phosphate dehydrogenase antikoerper, Glyceraldehyde 3 phosphate dehydrogenase 1 antikoerper, glyceraldehyde-3-phosphate dehydrogenase S homeolog antikoerper, glyceraldehyde-3-phosphate dehydrogenase, type I antikoerper, olfactory receptor 8K3 antikoerper, GAPDH antikoerper, Gapdh antikoerper, Gapdh1 antikoerper, gapdh antikoerper, gapdh.S antikoerper, gapDH antikoerper, LOC100404960 antikoerper, LOC614985 antikoerper
- Hintergrund
- GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).
- Molekulargewicht
- 36 kDa (MW of target protein)
-