Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) Antikörper
-
- Target Alle Chromosome 5 Open Reading Frame 39 (C5orf39) Antikörper anzeigen
- Chromosome 5 Open Reading Frame 39 (C5orf39)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C5 ORF39 antibody was raised against the N terminal Of C5 rf39
- Aufreinigung
- Affinity purified
- Immunogen
- C5 ORF39 antibody was raised using the N terminal Of C5 rf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
- Top Product
- Discover our top product C5orf39 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C5ORF39 Blocking Peptide, catalog no. 33R-2665, is also available for use as a blocking control in assays to test for specificity of this C5ORF39 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF39 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Chromosome 5 Open Reading Frame 39 (C5orf39)
- Andere Bezeichnung
- C5ORF39 (C5orf39 Produkte)
- Hintergrund
- C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
- Molekulargewicht
- 22 kDa (MW of target protein)
-