GTDC1 Antikörper (N-Term)

Produktnummer ABIN630762

Produktdetails anti-GTDC1 Antikörper

Target: GTDC1 (Glycosyltransferase-Like Domain Containing 1 (GTDC1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GTDC1 antibody was raised against the N terminal of GTDC1

Aufreinigung: Affinity purified

Immunogen: GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTDC1 Blocking Peptide, catalog no. 33R-1780, is also available for use as a blocking control in assays to test for specificity of this GTDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTDC1

Target: GTDC1 (Glycosyltransferase-Like Domain Containing 1 (GTDC1))

Andere Bezeichnung: GTDC1 (GTDC1 Produkte)

Synonyme: Hmat-Xa antikoerper, mat-Xa antikoerper, E330008O22Rik antikoerper, zgc:110568 antikoerper, glycosyltransferase like domain containing 1 antikoerper, glycosyltransferase-like domain containing 1 antikoerper, glycosyltransferase like domain containing 1 S homeolog antikoerper, GTDC1 antikoerper, Gtdc1 antikoerper, gtdc1.S antikoerper, gtdc1 antikoerper

Hintergrund: The function of GTDC1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 52 kDa (MW of target protein)