Homeotic Protein Proboscipedia Antikörper (Middle Region)

Produktnummer ABIN630765

Produktdetails anti-Homeotic Protein Proboscipedia Antikörper

Target: Homeotic Protein Proboscipedia (PB)

Bindungsspezifität: Middle Region

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Homeotic Protein Proboscipedia Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PB antibody was raised against the middle region of Pb

Aufreinigung: Affinity purified

Immunogen: PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PB Blocking Peptide, catalog no. 33R-2067, is also available for use as a blocking control in assays to test for specificity of this PB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Homeotic Protein Proboscipedia

Target: Homeotic Protein Proboscipedia (PB)

Andere Bezeichnung: PB (PB Produkte)

Hintergrund: Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.

Molekulargewicht: 83 kDa (MW of target protein)