MPP7 Antikörper
-
- Target Alle MPP7 Antikörper anzeigen
- MPP7 (Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPP7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MPP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL
- Top Product
- Discover our top product MPP7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPP7 Blocking Peptide, catalog no. 33R-6270, is also available for use as a blocking control in assays to test for specificity of this MPP7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPP7 (Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7))
- Andere Bezeichnung
- MPP7 (MPP7 Produkte)
- Synonyme
- 1110068J02Rik antikoerper, 2810038M04Rik antikoerper, 5430426E14Rik antikoerper, AI415104 antikoerper, Gm955 antikoerper, dlg3 antikoerper, hmp antikoerper, membrane palmitoylated protein 7 antikoerper, membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7) antikoerper, membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) antikoerper, MPP7 antikoerper, Mpp7 antikoerper, mpp7a antikoerper
- Hintergrund
- MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-