APPBP2 Antikörper
-
- Target Alle APPBP2 Antikörper anzeigen
- APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APPBP2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
- Top Product
- Discover our top product APPBP2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APPBP2 Blocking Peptide, catalog no. 33R-7479, is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPBP2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))
- Andere Bezeichnung
- APPBP2 (APPBP2 Produkte)
- Synonyme
- HS.84084 antikoerper, PAT1 antikoerper, 1300003O07Rik antikoerper, AI465480 antikoerper, zgc:76971 antikoerper, wu:fb78e11 antikoerper, wu:fc25c09 antikoerper, APPBP2 antikoerper, DKFZp459F0530 antikoerper, amyloid beta precursor protein binding protein 2 antikoerper, amyloid beta precursor protein (cytoplasmic tail) binding protein 2 antikoerper, amyloid beta precursor protein (cytoplasmic tail) binding protein 2 S homeolog antikoerper, APPBP2 antikoerper, Appbp2 antikoerper, appbp2 antikoerper, appbp2.S antikoerper
- Hintergrund
- APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.
- Molekulargewicht
- 67 kDa (MW of target protein)
-