METAP1 Antikörper (N-Term)

Produktnummer ABIN630774

Produktdetails anti-METAP1 Antikörper

Target: METAP1 (Methionyl Aminopeptidase 1 (METAP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser METAP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: METAP1 antibody was raised against the N terminal of METAP1

Aufreinigung: Affinity purified

Immunogen: METAP1 antibody was raised using the N terminal of METAP1 corresponding to a region with amino acids GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

METAP1 Blocking Peptide, catalog no. 33R-3198, is also available for use as a blocking control in assays to test for specificity of this METAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu METAP1

Target: METAP1 (Methionyl Aminopeptidase 1 (METAP1))

Andere Bezeichnung: METAP1 (METAP1 Produkte)

Synonyme: MGC64362 antikoerper, METAP1 antikoerper, metap1 antikoerper, DKFZp468B1413 antikoerper, LOC100228334 antikoerper, DDBDRAFT_0205763 antikoerper, DDBDRAFT_0235405 antikoerper, DDB_0205763 antikoerper, DDB_0235405 antikoerper, MAP1A antikoerper, MetAP1A antikoerper, 1700029C17Rik antikoerper, AW047992 antikoerper, mKIAA0094 antikoerper, Metap1 antikoerper, im:7047238 antikoerper, wu:fc84e12 antikoerper, zgc:110093 antikoerper, methionyl aminopeptidase 1 S homeolog antikoerper, methionyl aminopeptidase 1 antikoerper, methionine aminopeptidase 1 antikoerper, methionyl aminopeptidase 1 L homeolog antikoerper, metap1.S antikoerper, METAP1 antikoerper, metap1 antikoerper, Metap1 antikoerper, metap1.L antikoerper

Hintergrund: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling