GLT6D1 Antikörper (Middle Region)
-
- Target Alle GLT6D1 Antikörper anzeigen
- GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLT6D1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLT6 D1 antibody was raised against the middle region of GLT6 1
- Aufreinigung
- Affinity purified
- Immunogen
- GLT6 D1 antibody was raised using the middle region of GLT6 1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM
- Top Product
- Discover our top product GLT6D1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLT6D1 Blocking Peptide, catalog no. 33R-2916, is also available for use as a blocking control in assays to test for specificity of this GLT6D1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))
- Andere Bezeichnung
- GLT6D1 (GLT6D1 Produkte)
- Synonyme
- GLTDC1 antikoerper, GT6M7 antikoerper, GT6m7 antikoerper, Gltdc1 antikoerper, 4933411C14Rik antikoerper, QtsA-20904 antikoerper, glycosyltransferase 6 domain containing 1 antikoerper, GLT6D1 antikoerper, Glt6d1 antikoerper
- Hintergrund
- GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.
- Molekulargewicht
- 32 kDa (MW of target protein)
-