ALDOB Antikörper (Middle Region)
-
- Target Alle ALDOB Antikörper anzeigen
- ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDOB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALDOB antibody was raised against the middle region of ALDOB
- Aufreinigung
- Affinity purified
- Immunogen
- ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ
- Top Product
- Discover our top product ALDOB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDOB Blocking Peptide, catalog no. 33R-4503, is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))
- Andere Bezeichnung
- ALDOB (ALDOB Produkte)
- Synonyme
- aldb antikoerper, aldo2 antikoerper, xaldb antikoerper, ALDOB antikoerper, aldob antikoerper, ALDB antikoerper, ALDO2 antikoerper, Aldo-2 antikoerper, Aldo2 antikoerper, BC016435 antikoerper, LIV10 antikoerper, fb25f09 antikoerper, wu:fb25f09 antikoerper, aldolase B antikoerper, aldolase, fructose-bisphosphate B antikoerper, aldolase, fructose-bisphosphate B S homeolog antikoerper, aldolase b, fructose-bisphosphate antikoerper, aldolase B, fructose-bisphosphate antikoerper, xaldb antikoerper, aldob antikoerper, aldob.S antikoerper, ALDOB antikoerper, Aldob antikoerper
- Hintergrund
- Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.
- Molekulargewicht
- 39 kDa (MW of target protein)
-