Nephronectin Antikörper (Middle Region)

Produktnummer ABIN630784

Produktdetails anti-Nephronectin Antikörper

Target: Nephronectin (NPNT)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Nephronectin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Nephronectin antibody was raised against the middle region of NPNT

Aufreinigung: Affinity purified

Immunogen: Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Nephronectin Blocking Peptide, catalog no. 33R-9316, is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPNT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Nephronectin

Target: Nephronectin (NPNT)

Andere Bezeichnung: Nephronectin (NPNT Produkte)

Synonyme: POEM antikoerper, si:ch211-202n8.2 antikoerper, egfl6l antikoerper, 1110009H02Rik antikoerper, AA682063 antikoerper, AI314031 antikoerper, Nctn antikoerper, EGFL6L antikoerper, nephronectin antikoerper, NPNT antikoerper, npnt antikoerper, Npnt antikoerper

Hintergrund: NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Molekulargewicht: 62 kDa (MW of target protein)