Nephronectin Antikörper (Middle Region)
-
- Target Alle Nephronectin (NPNT) Antikörper anzeigen
- Nephronectin (NPNT)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nephronectin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Nephronectin antibody was raised against the middle region of NPNT
- Aufreinigung
- Affinity purified
- Immunogen
- Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE
- Top Product
- Discover our top product NPNT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Nephronectin Blocking Peptide, catalog no. 33R-9316, is also available for use as a blocking control in assays to test for specificity of this Nephronectin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPNT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nephronectin (NPNT)
- Andere Bezeichnung
- Nephronectin (NPNT Produkte)
- Hintergrund
- NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.
- Molekulargewicht
- 62 kDa (MW of target protein)
-