ABAT Antikörper (Middle Region)
-
- Target Alle ABAT Antikörper anzeigen
- ABAT (4-Aminobutyrate Aminotransferase (ABAT))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABAT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ABAT antibody was raised against the middle region of ABAT
- Aufreinigung
- Affinity purified
- Immunogen
- ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
- Top Product
- Discover our top product ABAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABAT Blocking Peptide, catalog no. 33R-4009, is also available for use as a blocking control in assays to test for specificity of this ABAT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABAT (4-Aminobutyrate Aminotransferase (ABAT))
- Andere Bezeichnung
- ABAT (ABAT Produkte)
- Synonyme
- cb880 antikoerper, fj82a01 antikoerper, wu:fj82a01 antikoerper, BA0325 antikoerper, PSPTO0259 antikoerper, PSPTO0301 antikoerper, PSPTO1890 antikoerper, GABA-AT antikoerper, GABAT antikoerper, NPD009 antikoerper, GABA-T antikoerper, L-AIBAT antikoerper, 9630038C02Rik antikoerper, AI255750 antikoerper, ENSMUSG00000051226 antikoerper, Gabaat antikoerper, Gabat antikoerper, Gm9851 antikoerper, I54 antikoerper, Laibat antikoerper, X61497 antikoerper, beta-AlaAT antikoerper, 4-aminobutyrate aminotransferase antikoerper, 4-aminobutyrate--2-oxoglutarate transaminase antikoerper, GABA aminotransferase PLP-dependent PuuE antikoerper, 4-aminobutyrate aminotransferase, mitochondrial antikoerper, aspartate aminotransferase family protein antikoerper, 4-aminobutyrate aminotransferase S homeolog antikoerper, ABAT antikoerper, abat antikoerper, gabT antikoerper, puuE antikoerper, gabT-1 antikoerper, gabT-2 antikoerper, gabT-3 antikoerper, CNE01830 antikoerper, Mmwyl1_0047 antikoerper, CpipJ_CPIJ008729 antikoerper, KCR_RS04555 antikoerper, Bcenmc03_4909 antikoerper, Hden_0972 antikoerper, Dbac_2000 antikoerper, Mesil_2400 antikoerper, Trad_0121 antikoerper, abat.S antikoerper, Abat antikoerper
- Hintergrund
- 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde
- Molekulargewicht
- 55 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-