HBXIP Antikörper (N-Term)
-
- Target Alle HBXIP Antikörper anzeigen
- HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Hepatitis B Virus (HBV)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HBXIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HBXIP antibody was raised against the N terminal of HBXIP
- Aufreinigung
- Affinity purified
- Immunogen
- HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR
- Top Product
- Discover our top product HBXIP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HBXIP Blocking Peptide, catalog no. 33R-2632, is also available for use as a blocking control in assays to test for specificity of this HBXIP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBXIP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HBXIP (Hepatitis B Virus X-Interacting Protein (HBXIP))
- Abstract
- HBXIP Produkte
- Substanzklasse
- Viral Protein
- Hintergrund
- HBXIP is a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus.
- Molekulargewicht
- 18 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signalweg, Regulation of Cell Size
-