TRIM45 Antikörper (N-Term)

Produktnummer ABIN630795

Produktdetails anti-TRIM45 Antikörper

Target: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIM45 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRIM45 antibody was raised against the N terminal of TRIM45

Aufreinigung: Affinity purified

Immunogen: TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIM45 Blocking Peptide, catalog no. 33R-2941, is also available for use as a blocking control in assays to test for specificity of this TRIM45 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM45 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIM45

Target: TRIM45 (Tripartite Motif Containing 45 (TRIM45))

Andere Bezeichnung: TRIM45 (TRIM45 Produkte)

Synonyme: RNF99 antikoerper, 4921530N01Rik antikoerper, tripartite motif containing 45 antikoerper, tripartite motif-containing 45 antikoerper, TRIM45 antikoerper, trim45 antikoerper, Trim45 antikoerper

Hintergrund: TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.

Molekulargewicht: 64 kDa (MW of target protein)