WDR4 Antikörper (N-Term)

Produktnummer ABIN630796

Produktdetails anti-WDR4 Antikörper

Target: WDR4 (WD Repeat Domain 4 (WDR4))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WDR4 antibody was raised against the N terminal of WDR4

Aufreinigung: Affinity purified

Immunogen: WDR4 antibody was raised using the N terminal of WDR4 corresponding to a region with amino acids FIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR4 Blocking Peptide, catalog no. 33R-2940, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR4

Target: WDR4 (WD Repeat Domain 4 (WDR4))

Andere Bezeichnung: WDR4 (WDR4 Produkte)

Synonyme: TRM82 antikoerper, TRMT82 antikoerper, AI415180 antikoerper, AI448349 antikoerper, D530049K22Rik antikoerper, WD repeat domain 4 antikoerper, WD repeat domain 4 S homeolog antikoerper, WDR4 antikoerper, Wdr4 antikoerper, wdr4.S antikoerper

Hintergrund: WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.

Molekulargewicht: 45 kDa (MW of target protein)