URGCP Antikörper (Middle Region)
-
- Target Alle URGCP Antikörper anzeigen
- URGCP (Upregulator of Cell Proliferation (URGCP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser URGCP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- URG4 antibody was raised against the middle region of URG4
- Aufreinigung
- Affinity purified
- Immunogen
- URG4 antibody was raised using the middle region of URG4 corresponding to a region with amino acids AILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLDPPGDLSR
- Top Product
- Discover our top product URGCP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
URG4 Blocking Peptide, catalog no. 33R-1272, is also available for use as a blocking control in assays to test for specificity of this URG4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of URG4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- URGCP (Upregulator of Cell Proliferation (URGCP))
- Andere Bezeichnung
- URG4 (URGCP Produkte)
- Synonyme
- URG4 antikoerper, DKFZp469D1721 antikoerper, urg4 antikoerper, MGC132266 antikoerper, 2010005J08Rik antikoerper, 9130001I21Rik antikoerper, AW060359 antikoerper, Urg4 antikoerper, mKIAA1507 antikoerper, RGD1564681 antikoerper, up-regulator of cell proliferation antikoerper, upregulator of cell proliferation antikoerper, LOC610578 antikoerper, LOC100064842 antikoerper, URGCP antikoerper, urgcp antikoerper, Urgcp antikoerper
- Hintergrund
- URG4 is upregulated in the presence of hepatitis B virus (HBV)-encoded X antigen (HBxAg) and may contribute to the development of hepatocellular carcinoma by promoting hepatocellular growth and survival.
- Molekulargewicht
- 100 kDa (MW of target protein)
-