GPSM2 Antikörper

Produktnummer ABIN630807

Produktdetails anti-GPSM2 Antikörper

Target: GPSM2 (G-Protein Signaling Modulator 2 (GPSM2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GPSM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPSM2 Blocking Peptide, catalog no. 33R-10101, is also available for use as a blocking control in assays to test for specificity of this GPSM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GPSM2

Target: GPSM2 (G-Protein Signaling Modulator 2 (GPSM2))

Andere Bezeichnung: GPSM2 (GPSM2 Produkte)

Synonyme: CMCS antikoerper, DFNB82 antikoerper, LGN antikoerper, PINS antikoerper, dfnb82 antikoerper, lgn antikoerper, pins antikoerper, RGD1560967 antikoerper, Pinsa antikoerper, zgc:63574 antikoerper, 6230410J09Rik antikoerper, Pins antikoerper, G protein signaling modulator 2 antikoerper, G-protein signaling modulator 2 S homeolog antikoerper, G-protein signaling modulator 2 antikoerper, G-protein signalling modulator 2 (AGS3-like, C. elegans) antikoerper, GPSM2 antikoerper, gpsm2.S antikoerper, Gpsm2 antikoerper, gpsm2 antikoerper

Hintergrund: Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.

Molekulargewicht: 76 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling