DAAM1 Antikörper (Middle Region)
-
- Target Alle DAAM1 Antikörper anzeigen
- DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DAAM1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DAAM1 antibody was raised against the middle region of DAAM1
- Aufreinigung
- Affinity purified
- Immunogen
- DAAM1 antibody was raised using the middle region of DAAM1 corresponding to a region with amino acids GNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEV
- Top Product
- Discover our top product DAAM1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DAAM1 Blocking Peptide, catalog no. 33R-3460, is also available for use as a blocking control in assays to test for specificity of this DAAM1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAAM1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAAM1 (Dishevelled Associated Activator of Morphogenesis 1 (DAAM1))
- Andere Bezeichnung
- DAAM1 (DAAM1 Produkte)
- Synonyme
- 1700066F09Rik antikoerper, 2310028E21Rik antikoerper, AI503486 antikoerper, E130308H01 antikoerper, mKIAA0666 antikoerper, daam-1 antikoerper, xdaam1 antikoerper, daam1 antikoerper, DAAM1 antikoerper, DKFZp468D0524 antikoerper, daam1l antikoerper, fc83b10 antikoerper, si:ch211-87i20.1 antikoerper, wu:fc83b10 antikoerper, dishevelled associated activator of morphogenesis 1 antikoerper, dishevelled associated activator of morphogenesis 1 S homeolog antikoerper, dishevelled associated activator of morphogenesis 1a antikoerper, dishevelled associated activator of morphogenesis 1b antikoerper, DAAM1 antikoerper, Daam1 antikoerper, daam1.S antikoerper, daam1a antikoerper, daam1 antikoerper, daam1b antikoerper
- Hintergrund
- The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein.
- Molekulargewicht
- 123 kDa (MW of target protein)
- Pathways
- WNT Signalweg
-