PRKX Antikörper (N-Term)
-
- Target Alle PRKX Antikörper anzeigen
- PRKX (Protein Kinase, X-Linked (PRKX))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKX antibody was raised against the N terminal of PRKX
- Aufreinigung
- Affinity purified
- Immunogen
- PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
- Top Product
- Discover our top product PRKX Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKX Blocking Peptide, catalog no. 33R-5894, is also available for use as a blocking control in assays to test for specificity of this PRKX antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKX antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKX (Protein Kinase, X-Linked (PRKX))
- Andere Bezeichnung
- PRKX (PRKX Produkte)
- Hintergrund
- This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis
-