GTPBP4 Antikörper (C-Term)

Produktnummer ABIN630811

Produktdetails anti-GTPBP4 Antikörper

Target: GTPBP4 (GTP Binding Protein 4 (GTPBP4))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTPBP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GTPBP4 antibody was raised against the C terminal of GTPBP4

Aufreinigung: Affinity purified

Immunogen: GTPBP4 antibody was raised using the C terminal of GTPBP4 corresponding to a region with amino acids MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTPBP4 Blocking Peptide, catalog no. 33R-6589, is also available for use as a blocking control in assays to test for specificity of this GTPBP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTPBP4

Target: GTPBP4 (GTP Binding Protein 4 (GTPBP4))

Andere Bezeichnung: GTPBP4 (GTPBP4 Produkte)

Synonyme: CRFG antikoerper, NGB antikoerper, NOG1 antikoerper, 2610028C09Rik antikoerper, Crfg antikoerper, Gtpbp3 antikoerper, Nog1 antikoerper, fi28d07 antikoerper, zgc:55757 antikoerper, wu:fi28d07 antikoerper, xgb antikoerper, GTP binding protein 4 antikoerper, GTP binding protein 4 L homeolog antikoerper, GTPBP4 antikoerper, Gtpbp4 antikoerper, gtpbp4 antikoerper, CC1G_14285 antikoerper, gtpbp4.L antikoerper

Hintergrund: GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and inactive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a signal to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.

Molekulargewicht: 74 kDa (MW of target protein)