Dnmt2 Antikörper (N-Term)

Produktnummer ABIN630813

Produktdetails anti-Dnmt2 Antikörper

Target: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Dnmt2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRDMT1 antibody was raised against the N terminal of TRDMT1

Aufreinigung: Affinity purified

Immunogen: TRDMT1 antibody was raised using the N terminal of TRDMT1 corresponding to a region with amino acids MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRDMT1 Blocking Peptide, catalog no. 33R-6114, is also available for use as a blocking control in assays to test for specificity of this TRDMT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRDMT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Dnmt2

Target: Dnmt2 (TRDMT1) (tRNA Aspartic Acid Methyltransferase 1 (TRDMT1))

Andere Bezeichnung: TRDMT1 (TRDMT1 Produkte)

Synonyme: MGC89267 antikoerper, DMNT2 antikoerper, DNMT2 antikoerper, MHSAIIP antikoerper, PUMET antikoerper, RNMT1 antikoerper, Dnmt2 antikoerper, Rnmt2 antikoerper, dnmt2 antikoerper, tRNA aspartic acid methyltransferase 1 antikoerper, tRNA aspartic acid methyltransferase 1 L homeolog antikoerper, trdmt1 antikoerper, TRDMT1 antikoerper, Trdmt1 antikoerper, trdmt1.L antikoerper

Hintergrund: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity.

Molekulargewicht: 44 kDa (MW of target protein)