Myoglobin Antikörper (N-Term)
(1 reference)-
- Target Alle Myoglobin (MB) Antikörper anzeigen
- Myoglobin (MB)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Myoglobin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Myoglobin antibody was raised against the N terminal of MB
- Aufreinigung
- Affinity purified
- Immunogen
- Myoglobin antibody was raised using the N terminal of MB corresponding to a region with amino acids MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
- Top Product
- Discover our top product MB Primärantikörper
-
anti-Myoglobin (MB) (AA 1-154) antibody
MB Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reaktivität: Schaf WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Myoglobin (MB) (AA 2-100) antibodyMB Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 4F8 unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reaktivität: Rind (Kuh) WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Myoglobin (MB) (AA 21-120) antibodyMB Reaktivität: Ratte, Maus, Schaf WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Myoglobin (MB) (AA 2-154) antibodyMB Reaktivität: Human, Ratte, Maus WB, ELISA, ICC, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Myoglobin (MB) antibodyMB Reaktivität: Human IHC, ELISA Wirt: Maus Monoclonal 5A2G8 unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C2 unconjugated
anti-Myoglobin (MB) (AA 1-154) antibodyMB Reaktivität: Schwein WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Myoglobin Blocking Peptide, catalog no. 33R-6045, is also available for use as a blocking control in assays to test for specificity of this Myoglobin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS, 0.09% sodium azide
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).
-
: "Neuroprotective effects of antibodies on retinal ganglion cells in an adolescent retina organ culture." in: Journal of neurochemistry, Vol. 139, Issue 2, pp. 256-269, (2016) (PubMed).
-
- Target
- Myoglobin (MB)
- Andere Bezeichnung
- Myoglobin (MB Produkte)
- Hintergrund
- This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.
- Molekulargewicht
- 17 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-
