HAL Antikörper (N-Term)

Produktnummer ABIN630816

Produktdetails anti-HAL Antikörper

Target: HAL (Histidine Ammonia-Lyase (HAL))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAL antibody was raised against the N terminal of HAL

Aufreinigung: Affinity purified

Immunogen: HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAL Blocking Peptide, catalog no. 33R-4075, is also available for use as a blocking control in assays to test for specificity of this HAL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAL

Target: HAL (Histidine Ammonia-Lyase (HAL))

Andere Bezeichnung: HAL (HAL Produkte)

Synonyme: HIS antikoerper, HSTD antikoerper, hal antikoerper, hstd antikoerper, xhal antikoerper, HAL antikoerper, BA3712 antikoerper, DDBDRAFT_0187742 antikoerper, DDBDRAFT_0231727 antikoerper, DDB_0187742 antikoerper, DDB_0231727 antikoerper, zgc:136980 antikoerper, his antikoerper, Hsd antikoerper, histidase antikoerper, histidine ammonia-lyase antikoerper, histidine ammonia-lyase, gene 1 L homeolog antikoerper, histidine ammonia-lyase HutH antikoerper, histidine ammonia-lyase, gene 1 antikoerper, histidine ammonia lyase antikoerper, HAL antikoerper, hal.1.L antikoerper, hutH antikoerper, Tc00.1047053506247.220 antikoerper, Plav_1493 antikoerper, hal antikoerper, hal.1 antikoerper, Hal antikoerper

Hintergrund: HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.

Molekulargewicht: 72 kDa (MW of target protein)