HAL Antikörper (N-Term)
-
- Target Alle HAL Antikörper anzeigen
- HAL (Histidine Ammonia-Lyase (HAL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HAL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HAL antibody was raised against the N terminal of HAL
- Aufreinigung
- Affinity purified
- Immunogen
- HAL antibody was raised using the N terminal of HAL corresponding to a region with amino acids INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET
- Top Product
- Discover our top product HAL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HAL Blocking Peptide, catalog no. 33R-4075, is also available for use as a blocking control in assays to test for specificity of this HAL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAL (Histidine Ammonia-Lyase (HAL))
- Andere Bezeichnung
- HAL (HAL Produkte)
- Hintergrund
- HAL is a cytosolic enzyme catalyzing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid. HAL defects cause histidinemia which is characterized by increased histidine and histamine and decreased urocanic acid in body fluids.
- Molekulargewicht
- 72 kDa (MW of target protein)
-