FBXO24 Antikörper (Middle Region)

Produktnummer ABIN630822

Produktdetails anti-FBXO24 Antikörper

Target: FBXO24 (F-Box Protein 24 (FBXO24))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXO24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXO24 antibody was raised against the middle region of FBXO24

Aufreinigung: Affinity purified

Immunogen: FBXO24 antibody was raised using the middle region of FBXO24 corresponding to a region with amino acids EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXO24 Blocking Peptide, catalog no. 33R-2436, is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXO24

Target: FBXO24 (F-Box Protein 24 (FBXO24))

Andere Bezeichnung: FBXO24 (FBXO24 Produkte)

Synonyme: FBX24 antikoerper, 4933422D21Rik antikoerper, Fbx24 antikoerper, F-box protein 24 antikoerper, FBXO24 antikoerper, Fbxo24 antikoerper, fbxo24 antikoerper

Hintergrund: FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Molekulargewicht: 36 kDa (MW of target protein)