LIAS Antikörper (C-Term)

Produktnummer ABIN630828

Produktdetails anti-LIAS Antikörper

Target: LIAS (Lipoic Acid Synthetase (LIAS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LIAS antibody was raised against the C terminal of LIAS

Aufreinigung: Affinity purified

Immunogen: LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIAS Blocking Peptide, catalog no. 33R-2822, is also available for use as a blocking control in assays to test for specificity of this LIAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIAS

Target: LIAS (Lipoic Acid Synthetase (LIAS))

Andere Bezeichnung: LIAS (LIAS Produkte)

Synonyme: LAS antikoerper, LIP1 antikoerper, LS antikoerper, PDHLD antikoerper, 2900022L22Rik antikoerper, 4933425M12Rik antikoerper, 7a5ex antikoerper, C77512 antikoerper, mLip1 antikoerper, zgc:66080 antikoerper, Lip-syn antikoerper, lipoyl synthase, mitochondrial antikoerper, lipoic acid synthetase antikoerper, lipoyl synthase antikoerper, lipoic acid synthetase S homeolog antikoerper, Lipoyl synthase, mitochondrial antikoerper, LOC5571879 antikoerper, THAPSDRAFT_31845 antikoerper, THAPSDRAFT_31673 antikoerper, UREG_00501 antikoerper, LOAG_04019 antikoerper, TERG_02451 antikoerper, Tsp_01534 antikoerper, LIAS antikoerper, Lias antikoerper, lias antikoerper, lias.S antikoerper, umc2251 antikoerper

Hintergrund: LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Tube Formation