LIAS Antikörper (C-Term)

Produktnummer ABIN630828

Produktdetails anti-LIAS Antikörper

Target: LIAS (Lipoic Acid Synthetase (LIAS))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LIAS antibody was raised against the C terminal of LIAS

Aufreinigung: Affinity purified

Immunogen: LIAS antibody was raised using the C terminal of LIAS corresponding to a region with amino acids EYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LIAS Blocking Peptide, catalog no. 33R-2822, is also available for use as a blocking control in assays to test for specificity of this LIAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIAS

Target: LIAS (Lipoic Acid Synthetase (LIAS))

Andere Bezeichnung: LIAS (LIAS Produkte)

Hintergrund: LIAS belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Tube Formation