ATE1 Antikörper (N-Term)

Produktnummer ABIN630829

Produktdetails anti-ATE1 Antikörper

Target: ATE1 (Arginyltransferase 1 (ATE1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATE1 antibody was raised against the N terminal of ATE1

Aufreinigung: Affinity purified

Immunogen: ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATE1 Blocking Peptide, catalog no. 33R-1654, is also available for use as a blocking control in assays to test for specificity of this ATE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATE1

Target: ATE1 (Arginyltransferase 1 (ATE1))

Andere Bezeichnung: ATE1 (ATE1 Produkte)

Synonyme: ATE1 antikoerper, Ate antikoerper, CG9204 antikoerper, Dm-Ate1 antikoerper, Dmel\\CG9204 antikoerper, ate1 antikoerper, l(2)k10809 antikoerper, zgc:158849 antikoerper, AI225793 antikoerper, AW547406 antikoerper, CG9204 gene product from transcript CG9204-RA antikoerper, arginyltransferase 1 antikoerper, arginyltransferase 1 L homeolog antikoerper, Ate1 antikoerper, ATE1 antikoerper, ate1 antikoerper, ate1.L antikoerper

Hintergrund: ATE1 is an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in two transcript variants encoding distinct isoforms.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom