NHEDC1 Antikörper (N-Term)
-
- Target Alle NHEDC1 Antikörper anzeigen
- NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))
-
Bindungsspezifität
- N-Term
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NHEDC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NHEDC1 antibody was raised against the N terminal of NHEDC1
- Aufreinigung
- Affinity purified
- Immunogen
- NHEDC1 antibody was raised using the N terminal of NHEDC1 corresponding to a region with amino acids MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAHEETKTVLSDTEEIKPQT
- Top Product
- Discover our top product NHEDC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NHEDC1 Blocking Peptide, catalog no. 33R-6104, is also available for use as a blocking control in assays to test for specificity of this NHEDC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NHEDC1 (Na+/H+ Exchanger Domain Containing 1 (NHEDC1))
- Andere Bezeichnung
- NHEDC1 (NHEDC1 Produkte)
- Synonyme
- NHA1 antikoerper, NHEDC1 antikoerper, 1700094G20Rik antikoerper, 4933424B12Rik antikoerper, 4933425K02Rik antikoerper, AV258602 antikoerper, Nhedc1 antikoerper, mtsNHE antikoerper, solute carrier family 9 member B1 antikoerper, solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1 antikoerper, SLC9B1 antikoerper, Slc9b1 antikoerper
- Hintergrund
- NHEDC1 is a sodium/hydrogen exchanger and transmembrane protein. Highly conserved orthologs of this gene have been found in other mammalian species. The expression of NHEDC1 may be limited to testis.
- Molekulargewicht
- 52 kDa (MW of target protein)
-