Transglutaminase 5 Antikörper (C-Term)
-
- Target Alle Transglutaminase 5 (TGM5) Antikörper anzeigen
- Transglutaminase 5 (TGM5)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Transglutaminase 5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Transglutaminase 5 antibody was raised against the C terminal of TGM5
- Aufreinigung
- Affinity purified
- Immunogen
- Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
- Top Product
- Discover our top product TGM5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Transglutaminase 5 Blocking Peptide, catalog no. 33R-9671, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Transglutaminase 5 (TGM5)
- Andere Bezeichnung
- Transglutaminase 5 (TGM5 Produkte)
- Synonyme
- TGM5 antikoerper, TGASE5 antikoerper, TGASEX antikoerper, TGMX antikoerper, TGX antikoerper, 2310007C07Rik antikoerper, TGx antikoerper, transglutaminase 5 antikoerper, TGM5 antikoerper, tgm5 antikoerper, Tgm5 antikoerper
- Hintergrund
- TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).
- Molekulargewicht
- 81 kDa (MW of target protein)
-