Cytokeratin 13 Antikörper (N-Term)
-
- Target Alle Cytokeratin 13 (KRT13) Antikörper anzeigen
- Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cytokeratin 13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cytokeratin 13 antibody was raised against the N terminal of KRT13
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY
- Top Product
- Discover our top product KRT13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 13 Blocking Peptide, catalog no. 33R-9208, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))
- Andere Bezeichnung
- Cytokeratin 13 (KRT13 Produkte)
- Synonyme
- krt13 antikoerper, CK13 antikoerper, K13 antikoerper, Ka13 antikoerper, Krt-1.13 antikoerper, Krt1-13 antikoerper, ck13 antikoerper, k13 antikoerper, keratin 24 antikoerper, keratin 13 antikoerper, keratin 13, type I S homeolog antikoerper, krt24 antikoerper, KRT13 antikoerper, Krt13 antikoerper, krt13.S antikoerper, k13 antikoerper
- Hintergrund
- KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.
- Molekulargewicht
- 46 kDa (MW of target protein)
-