FLII Antikörper
-
- Target Alle FLII Antikörper anzeigen
- FLII (Flightless I Homolog (FLII))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FLII Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR
- Top Product
- Discover our top product FLII Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLII Blocking Peptide, catalog no. 33R-4761, is also available for use as a blocking control in assays to test for specificity of this FLII antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLII antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLII (Flightless I Homolog (FLII))
- Andere Bezeichnung
- FLII (FLII Produkte)
- Synonyme
- FLI antikoerper, FLIL antikoerper, Fli1 antikoerper, 3632430F08Rik antikoerper, Fliih antikoerper, im:7141769 antikoerper, DKFZp459O043 antikoerper, flightless antikoerper, FLII, actin remodeling protein antikoerper, flightless I actin binding protein antikoerper, protein flightless-1 homolog antikoerper, FLII, actin remodeling protein S homeolog antikoerper, Protein flightless-1 homolog antikoerper, FLII antikoerper, Flii antikoerper, flii antikoerper, LOC585336 antikoerper, LOC100640615 antikoerper, flii.S antikoerper, fli-1 antikoerper
- Hintergrund
- FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
- Molekulargewicht
- 145 kDa (MW of target protein)
-