Peroxiredoxin 2 Antikörper (Middle Region)
-
- Target Alle Peroxiredoxin 2 (PRDX2) Antikörper anzeigen
- Peroxiredoxin 2 (PRDX2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Peroxiredoxin 2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRDX2 antibody was raised against the middle region of PRDX2
- Aufreinigung
- Affinity purified
- Immunogen
- PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD
- Top Product
- Discover our top product PRDX2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRDX2 Blocking Peptide, catalog no. 33R-9664, is also available for use as a blocking control in assays to test for specificity of this PRDX2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Peroxiredoxin 2 (PRDX2)
- Andere Bezeichnung
- PRDX2 (PRDX2 Produkte)
- Synonyme
- NKEF-B antikoerper, NKEFB antikoerper, PRP antikoerper, PRX2 antikoerper, PRXII antikoerper, PTX1 antikoerper, TDPX1 antikoerper, TPX1 antikoerper, TSA antikoerper, AL022839 antikoerper, Band-8 antikoerper, NkefB antikoerper, PrxII antikoerper, TDX1 antikoerper, TPx antikoerper, TPx-B antikoerper, TR antikoerper, Tdpx1 antikoerper, Torin antikoerper, nkefb antikoerper, prx-2 antikoerper, prx2 antikoerper, prxii antikoerper, tdpx1 antikoerper, tpx1 antikoerper, peroxiredoxin 2 antikoerper, peroxiredoxin 2 L homeolog antikoerper, PRDX2 antikoerper, Prdx2 antikoerper, prdx2.L antikoerper
- Hintergrund
- PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.
- Molekulargewicht
- 22 kDa (MW of target protein)
-