SPNS2 Antikörper
-
- Target Alle SPNS2 Antikörper anzeigen
- SPNS2 (Spinster Homolog 2 (SPNS2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPNS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SPNS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPGTPGTPGCAATAKGPGAQQPKPASLGRGRGAAAAILSLGNVLNYLDRY
- Top Product
- Discover our top product SPNS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPNS2 Blocking Peptide, catalog no. 33R-7255, is also available for use as a blocking control in assays to test for specificity of this SPNS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPNS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPNS2 (Spinster Homolog 2 (SPNS2))
- Andere Bezeichnung
- SPNS2 (SPNS2 Produkte)
- Synonyme
- fi20h04 antikoerper, si:dkey-7b17.4 antikoerper, toh antikoerper, wu:fi20h04 antikoerper, DKFZp459J1933 antikoerper, spinster homolog 2 (Drosophila) antikoerper, sphingolipid transporter 2 antikoerper, spinster homolog 2 antikoerper, SPNS2 antikoerper, spns2 antikoerper, Spns2 antikoerper
- Hintergrund
- SPNS2 is the sphingolipid transporter required for migration of myocardial precursors. SPNS2 transports sphingosine 1-phosphate (S1P), a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. SPNS2 mediates the export of S1P from cells in the extraembryonic yolk syncytial layer (YSL), thereby regulating myocardial precursor migration.
- Molekulargewicht
- 60 kDa (MW of target protein)
-