GC-Rich Promoter Binding Protein 1 (GPBP1) (N-Term) Antikörper

Produktnummer ABIN630853

Produktdetails

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: DKFZP761 C169 antibody was raised against the N terminal Of Dkfzp761 169

Aufreinigung: Affinity purified

Immunogen: DKFZP761 C169 antibody was raised using the N terminal Of Dkfzp761 169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DKFZP761C169 Blocking Peptide, catalog no. 33R-7991, is also available for use as a blocking control in assays to test for specificity of this DKFZP761C169 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP760 169 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: GC-Rich Promoter Binding Protein 1 (GPBP1)

Abstract: GPBP1 Produkte

Synonyme: MGC80437 antikoerper, Vasculin antikoerper, DKFZp459A203 antikoerper, GPBP antikoerper, SSH6 antikoerper, VASCULIN antikoerper, 1700034P14Rik antikoerper, AU019836 antikoerper, D230035M11Rik antikoerper, Gpbp antikoerper, mGPBP antikoerper, RGD1305492 antikoerper, GC-rich promoter binding protein 1 L homeolog antikoerper, GC-rich promoter binding protein 1 antikoerper, gpbp1.L antikoerper, gpbp1 antikoerper, GPBP1 antikoerper, Gpbp1 antikoerper

Hintergrund: Vasculin is a novel vascular protein differentially expressed in human atherogenesis.

Molekulargewicht: 52 kDa (MW of target protein)