FKBP3 Antikörper (C-Term)

Produktnummer ABIN630860

Produktdetails anti-FKBP3 Antikörper

Target: FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FKBP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FKBP3 antibody was raised against the C terminal of FKBP3

Aufreinigung: Affinity purified

Immunogen: FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FKBP3 Blocking Peptide, catalog no. 33R-2266, is also available for use as a blocking control in assays to test for specificity of this FKBP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FKBP3

Target: FKBP3 (FK506 Binding Protein 3, 25kDa (FKBP3))

Andere Bezeichnung: FKBP3 (FKBP3 Produkte)

Synonyme: FKBP3 antikoerper, 25kDa antikoerper, FKBP-3 antikoerper, FKBP25 antikoerper, FK506 antikoerper, fb75c04 antikoerper, si:dz261o22.2 antikoerper, wu:fb75c04 antikoerper, zgc:110728 antikoerper, FKBP-25 antikoerper, PPIase antikoerper, FK506 binding protein 3 antikoerper, FK506 binding protein 3 L homeolog antikoerper, peptidylprolyl isomerase antikoerper, FKBP3 antikoerper, Fkbp3 antikoerper, fkbp3 antikoerper, fkbp3.L antikoerper, CAALFM_C103790CA antikoerper

Hintergrund: FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Molekulargewicht: 25 kDa (MW of target protein)