POLR3B Antikörper (C-Term)

Produktnummer ABIN630870

Produktdetails anti-POLR3B Antikörper

Target: POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLR3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: POLR3 B antibody was raised against the C terminal of POLR3

Aufreinigung: Affinity purified

Immunogen: POLR3 B antibody was raised using the C terminal of POLR3 corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLR3B Blocking Peptide, catalog no. 33R-3943, is also available for use as a blocking control in assays to test for specificity of this POLR3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLR3B

Target: POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))

Andere Bezeichnung: POLR3B (POLR3B Produkte)

Synonyme: RGD1565311 antikoerper, C128 antikoerper, HLD8 antikoerper, RPC2 antikoerper, 2700078H01Rik antikoerper, A330032P03Rik antikoerper, C85372 antikoerper, RNA polymerase III subunit B antikoerper, polymerase (RNA) III (DNA directed) polypeptide B antikoerper, Polr3b antikoerper, POLR3B antikoerper

Hintergrund: POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.

Molekulargewicht: 128 kDa (MW of target protein)