POLR3B Antikörper (C-Term)
-
- Target Alle POLR3B Antikörper anzeigen
- POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POLR3B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POLR3 B antibody was raised against the C terminal of POLR3
- Aufreinigung
- Affinity purified
- Immunogen
- POLR3 B antibody was raised using the C terminal of POLR3 corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED
- Top Product
- Discover our top product POLR3B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POLR3B Blocking Peptide, catalog no. 33R-3943, is also available for use as a blocking control in assays to test for specificity of this POLR3B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR3B (Polymerase (RNA) III (DNA Directed) Polypeptide B (POLR3B))
- Andere Bezeichnung
- POLR3B (POLR3B Produkte)
- Hintergrund
- POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
- Molekulargewicht
- 128 kDa (MW of target protein)
-