PHACTR3 Antikörper (C-Term)
-
- Target Alle PHACTR3 Antikörper anzeigen
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PHACTR3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PHACTR3 antibody was raised against the C terminal of PHACTR3
- Aufreinigung
- Affinity purified
- Immunogen
- PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
- Top Product
- Discover our top product PHACTR3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PHACTR3 Blocking Peptide, catalog no. 33R-3947, is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHACTR3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHACTR3 (Phosphatase and Actin Regulator 3 (PHACTR3))
- Andere Bezeichnung
- PHACTR3 (PHACTR3 Produkte)
- Hintergrund
- PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.
- Molekulargewicht
- 51 kDa (MW of target protein)
-