PECI/ECI2 Antikörper (Middle Region)
-
- Target Alle PECI/ECI2 (PECI) Antikörper anzeigen
- PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PECI/ECI2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PECI antibody was raised against the middle region of PECI
- Aufreinigung
- Affinity purified
- Immunogen
- PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK
- Top Product
- Discover our top product PECI Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PECI Blocking Peptide, catalog no. 33R-1595, is also available for use as a blocking control in assays to test for specificity of this PECI antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PECI antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PECI/ECI2 (PECI) (Enoyl-CoA Delta Isomerase 2 (PECI))
- Andere Bezeichnung
- PECI (PECI Produkte)
- Hintergrund
- PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.
- Molekulargewicht
- 40 kDa (MW of target protein)
-